SBP

New SBP Bacterial System Expression Vectors
for Simple Purification and Detection Using Streptavidin Products

The new SBP (Streptavidin Binding Peptide) tag provides for one-step purification and detection of recombinant protein from bacterial lysates due to nanomolar affinity for streptavidin. SBP offers high-affinity, high yield, mild elution conditions and simplicity in recombinant protein purification. In addition, the tag provides versatility in downstream detection and assays due to the widely available streptavidin-conjugated fluorescent and enzymatic systems.

• 38 amino acid tag (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP)
• One-step purification and detection
• For use with widely available streptavidin products (resins, enzyme conjugates, plates, etc.)
• Mild, specific elution of native protein using biotin
• Higher purity than Maltose Binding Protein or HIS-tag¹
• Expression vectors containing the tac or T7 promoters

Cytoplasmic expression of C-terminal fusion Ampicillin resistance, T1T2 transcriptional terminator, pMB1(derivative of pBR322) origin of replication, and lacI gene for repression of the tac promoter Expression levels using the tac promoter may be in excess of 10 mg/L of culture when using IPTG as a de-repressor Expression in any established Escherichia coli expression host

Product	MCS Region
P3996, pTAC-SBP-1 C-terminal SBP

back to top

Cytoplasmic expression N- or C- terminal fusions Ampicillin resistance, T1T2 transcriptional terminator, pMB1 (derivative of pBR322) origin of replication, and lacI gene for repression of the T7 promoter Higher yields of recombinant protein than tac system lac operator (lacO) sequences reduce "leaky" expression Requires hosts with a source of the T7 polymerase such as (DE3) lysogenic strains Enterokinase cleavage of N-terminal SBP

Product	MCS Region
P3746, pT7-SBP-1 C-terminal SBP
E9655, pT7-SBP-2 N-terminal SBP

Reference

1. Keefe, A. D., et al., Protein Expr. Purif., 23, 440-446 (2001).

back to top
back to Expression Vectors