AV40354 Sigma

Anti-CSTF3 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

DOWNLOAD MSDS (PDF)

Synonym: Anti-Cleavage stimulation factor, 3′ pre-RNA, subunit 3, 77 kDa

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for RNA Regulation and Translation, Antibodies to RNA Binding Proteins, Antibodies to Ribosomal Proteins and Translation Factors,
species reactivity   canine, zebrafish, human, mouse, rat, bovine, chicken,
application(s)   western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   lyophilized powder
immunogen sequence   IEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEK
storage temp.   −20°C
Gene Information   human ... CSTF3(1479)
NCBI accession no.   NP_001317

Description

Immunogen

synthetic peptide corresponding to a region of human CSTF3 with an internal ID of P10391

Physical form

Lyophilized from PBS buffer with 2% sucrose

Price and Availability

Anti-Rabbit 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A0545HRPAnti-Rabbit IgG (whole molecule)-Peroxidase
A3687APAnti-Rabbit IgG (whole molecule)-Alkaline Phosphatase
F0382FITCAnti-Rabbit IgG (whole molecule)-FITC
B8895BiotinAnti-Rabbit IgG (whole molecule)-Biotin





Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?