AV41934 Sigma

Anti-CRMP1 (AB2) antibody produced in rabbit

affinity isolated antibody, lyophilized powder

DOWNLOAD MSDS (PDF)

Synonym: Anti-Collapsin response mediator protein 1, Anti-DPYSL1, Anti-DRP-1, Anti-DRP1

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Neurobiology, Antibodies to Neural Proteins, CR-CR,
species reactivity   zebrafish, bovine, canine, chicken, human, mouse, rat
application(s)   western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   lyophilized powder
immunogen sequence   PSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG
storage temp.   −20°C
Gene Information   human ... CRMP1(1400)
NCBI accession no.   NP_001304

Description

Immunogen

synthetic peptide corresponding to a region of human CRMP1 with an internal ID of P12528

Physical form

Lyophilized from PBS buffer with 2% sucrose

Price and Availability

Anti-Rabbit 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A0545HRPAnti-Rabbit IgG (whole molecule)-Peroxidase
A3687APAnti-Rabbit IgG (whole molecule)-Alkaline Phosphatase
F0382FITCAnti-Rabbit IgG (whole molecule)-FITC
B8895BiotinAnti-Rabbit IgG (whole molecule)-Biotin





Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?