• USA Home
  • WH0009112M2 - Monoclonal Anti-MTA1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
WH0009112M2 Sigma

Monoclonal Anti-MTA1 antibody produced in mouse

clone 4D11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-metastasis associated 1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies in Chromatin Remodeling, Antibodies to Most Studied Epigenetic Genes, Antibodies to Remodeling Complex,
species reactivity   mouse
application(s)   indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: suitable
clone   4D11, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG3κ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... MTA1(9112)
biological source   mouse
conjugate   unconjugated
GenBank® accession no.   NM_004689

Description

Immunogen

MTA1 (NP_004680, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP

General description

This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?