• USA Home
  • WH0009112M2 - Monoclonal Anti-MTA1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND

WH0009112M2 Sigma

Monoclonal Anti-MTA1 antibody produced in mouse

clone 4D11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-metastasis associated 1

Properties

Related Categories 4C-4E, Alphabetical Index, Antibodies, Antibodies in Chromatin Remodeling, Antibodies to Most Studied Epigenetic Genes,
species reactivity   mouse
application(s)   indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: suitable
clone   4D11, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG3κ
immunogen sequence   MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP* (without GST)
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... MTA1(9112)
conjugate   unconjugated

Description

Immunogen

MTA1 (NP_004680, a.a. 601-701) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Physical form

Solution in phosphate buffered saline, pH 7.2

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


New TruPAGE™ Pre-cast Polyacrylamide Gels

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?