SAB1403690 Sigma

Monoclonal Anti-CPS1, (C-terminal) antibody produced in mouse

clone 4A10, purified immunoglobulin, buffered aqueous solution

DOWNLOAD MSDS (PDF)

Properties

Related Categories 4-4B, Alphabetical Index, Antibodies, CO-CP, Clone Index,
species reactivity   human
application(s)   indirect ELISA: suitable
  western blot: suitable
clone   4A10, monoclonal
concentration   ~1 mg/mL
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG1λ
immunogen sequence   ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA*
mol wt   antigen mol wt ~37.22 kDa
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... CPS1(1373)
NCBI accession no.   NM_001875

Description

Immunogen

CPS1 (NP_001866, 1400 a.a. ~ 1501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

General description

Mouse monoclonal antibody raised against a partial recombinant CPS1.

Physical form

Clear, colorless solution in phosphate buffered saline, pH 7.2

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Mouse 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A4416HRPAnti-Mouse IgG (whole molecule)-Peroxidase
A3562APAnti-Mouse IgG (whole molecule)-Alkaline Phosphatase
F0257FITCAnti-Mouse IgG (whole molecule)-FITC
B7264BiotinAnti-Mouse IgG (whole molecule)-Biotin





Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?