SAB2101838 Sigma

Anti-POLD2 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

DOWNLOAD MSDS (PDF)

Synonym: Anti-Polymerase (DNA directed), delta 2, regulatory subunit 50kDa

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Cell Stress, Antibodies to DNA Repair Proteins,
species reactivity   bovine, human, mouse, rat
application(s)   western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   lyophilized powder
immunogen sequence   LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT
storage temp.   −20°C
Gene Information   human ... POLD2(5425)

Description

Immunogen

Peptide region of the protein sequence according to NP_006221.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Rabbit 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A0545HRPAnti-Rabbit IgG (whole molecule)-Peroxidase
A3687APAnti-Rabbit IgG (whole molecule)-Alkaline Phosphatase
F0382FITCAnti-Rabbit IgG (whole molecule)-FITC
B8895BiotinAnti-Rabbit IgG (whole molecule)-Biotin





Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?