WH0149420M1 Sigma

Monoclonal Anti-PDIK1L antibody produced in mouse

clone 4B7, purified immunoglobulin, buffered aqueous solution

DOWNLOAD MSDS (PDF)

Synonym: Anti-CLIK1L, Anti-PDLIM1 interacting kinase 1 like, Anti-RP1196L14.4

Properties

Related Categories 4-4B, Alphabetical Index, Antibodies, Clone Index, PD-PG,
species reactivity   human
application(s)   indirect ELISA: suitable
clone   4B7, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG1κ
immunogen sequence   MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVET* (without GST)
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... PDIK1L(149420)

Description

Immunogen

PDIK1L (NP_690048, a.a. 1-100) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.

Physical form

Solution in phosphate buffered saline, pH 7.2

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Mouse 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A4416HRPAnti-Mouse IgG (whole molecule)-Peroxidase
A3562APAnti-Mouse IgG (whole molecule)-Alkaline Phosphatase
F0257FITCAnti-Mouse IgG (whole molecule)-FITC
B7264BiotinAnti-Mouse IgG (whole molecule)-Biotin





Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?