• USA Home
  • AMAB90624 - Monoclonal Anti-TSPAN7 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
AMAB90624 Sigma

Monoclonal Anti-TSPAN7 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0265, purified immunoglobulin, buffered aqueous glycerol solution

Synonym: Anti-A15, Anti-CD231, Anti-DXS1692E, Anti-MRX58, Anti-MXS1, Anti-TALLA-1, Anti-TM4SF2

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, TS-TZ
species reactivity   human
application(s)   immunohistochemistry: 1:200- 1:500
clone   CL0265, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous glycerol solution
isotype   IgG1
grade   Prestige Antibodies® Powered by Atlas Antibodies
epitope sequence   TDCNPQDLHNLTVAA
immunogen sequence   TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... TSPAN7(7102)
biological source   mouse
conjugate   unconjugated

Description

Immunogen

tetraspanin 7, recombinant protein epitope signature tag (PrEST)

Physical form

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST74399.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Protocols

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Polyclonals or Monoclonals are recommended to use according to the standard Prestige Antigen-blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?