• USA Home
  • APREST74748 - PrEST Antigen TUFM

EMAIL THIS PAGE TO A FRIEND
APREST74748 Sigma

PrEST Antigen TUFM

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym: EF-TuMT, EFTu

Purchase

Properties

Related Categories Antibodies, Prestige Antigens, Prestige Antigens S - T More...
recombinant   expressed in E. coli
assay   >80% (SDS-PAGE)
form   buffered aqueous solution
mol wt   predicted mol wt 29 kDa
purified by   immobilized metal affinity chromatography (IMAC)
concentration   ≥0.5 mg/mL
immunogen sequence   AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI
Ensembl | human accession no.   ENSG00000178952
UniProt accession no.   P49411
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... TUFM(7284)

Description

Application

Suitable as a blocking agent using corresponding antibodies.

General description

Recombinant protein fragment of Human TUFM with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Linkage

Corresponding Antibodies AMAB90964 , AMAB90965 , AMAB90966 , HPA024087.

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
2

Documents

Certificate of Analysis

Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?