• USA Home
  • APREST78615 - PrEST Antigen PGAM5

EMAIL THIS PAGE TO A FRIEND
APREST78615 Sigma

PrEST Antigen PGAM5

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym: BXLBv68, MGC5352

Purchase

Properties

Related Categories Antibodies, Prestige Antigens, Prestige Antigens O - P More...
recombinant   expressed in E. coli
assay   >80% (SDS-PAGE)
form   buffered aqueous solution
mol wt   predicted mol wt 28 kDa
purified by   immobilized metal affinity chromatography (IMAC)
concentration   ≥0.5 mg/mL
immunogen sequence   NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Ensembl | human accession no.   ENSG00000247077
UniProt accession no.   Q96HS1
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PGAM5(192111)

Description

Application

Suitable as a blocking agent using corresponding antibodies.

General description

Recombinant protein fragment of Human PGAM5 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Linkage

Corresponding Antibodies AMAB90803 , HPA036978.

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
2

Documents

Certificate of Analysis

Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?