• USA Home
  • APREST83606 - PrEST Antigen HS2ST1

EMAIL THIS PAGE TO A FRIEND
APREST83606 Sigma

PrEST Antigen HS2ST1

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Synonym: KIAA0448

Purchase

Properties

Related Categories Antibodies, Prestige Antigens, Prestige Antigens G - H More...
recombinant   expressed in E. coli
assay   >80% (SDS-PAGE)
form   buffered aqueous solution
mol wt   predicted mol wt 27 kDa
purified by   immobilized metal affinity chromatography (IMAC)
concentration   ≥0.5 mg/mL
immunogen sequence   LRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLE
Ensembl | human accession no.   ENSG00000153936
UniProt accession no.   Q7LGA3
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... HS2ST1(339524)

Description

Application

Suitable as a blocking agent using corresponding antibodies.

General description

Recombinant protein fragment of Human HS2ST1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Linkage

Corresponding Antibody HPA043603.

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Physical form

Solution in 1 M urea-PBS, pH 7.4

Legal Information

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
2

Documents

Certificate of Analysis

Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?