AV40965 Sigma

Anti-PTBP2 antibody produced in rabbit

IgG fraction of antiserum, lyophilized powder

Synonym: Anti-Polypyrimidine tract binding protein 2

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to RNA Binding Proteins, Epigenetics, PT-PY,
species reactivity   canine, bovine, human, mouse, rat
application(s)   western blot: suitable
clone   polyclonal
antibody form   IgG fraction of antiserum
form   lyophilized powder
immunogen sequence   DGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGED
storage temp.   −20°C
Gene Information   human ... PTBP2(58155)
NCBI accession no.   NP_067013

Description

Immunogen

synthetic peptide corresponding to a region of human PTBP2 with an internal ID of P10633

Physical form

Lyophilized from PBS buffer with 2% sucrose

Price and Availability

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?