• USA Home
  • AV40965 - Anti-PTBP2 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND

AV40965 Sigma

Anti-PTBP2 antibody produced in rabbit

IgG fraction of antiserum

Synonym: Anti-Polypyrimidine tract binding protein 2

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to RNA Binding Proteins, Epigenetics, PT-PY,
species reactivity   human, mouse, canine, bovine, guinea pig, rat
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   IgG fraction of antiserum
form   buffered aqueous solution
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PTBP2(58155)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NP_067013

Description

Immunogen

The immunogen for anti-PTBP2 antibody: synthetic peptide derected towards the N terminal of human PTBP2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE

Price and Availability

Customers Also Viewed

Anti-PTBP2, (N-terminal) antibody produced in rabbit

~1 mg/mL, affinity isolated antibody

Monoclonal Anti-PTBP2 antibody produced in mouse

clone 2D10-B2, purified immunoglobulin, buffered aqueous solution

Monoclonal Anti-PTBP2 antibody produced in mouse

clone 2B11, purified immunoglobulin, buffered aqueous solution

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?