AV41054 Sigma

Anti-MKI67IP antibody produced in rabbit

affinity isolated antibody, lyophilized powder

DOWNLOAD MSDS (PDF)

Synonym: Anti-MKI67 (FHA domain) interacting nucleolar phosphoprotein, Anti-NIFK, Anti-Nopp34

Properties

Related Categories Alphabetical Index, Antibodies, MF-MN, Primary Antibodies
species reactivity   human, mouse, pig, canine, rat, bovine
application(s)   western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   lyophilized powder
immunogen sequence   PSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKT
storage temp.   −20°C
Gene Information   human ... MKI67IP(84365)
NCBI accession no.   NP_115766

Description

Immunogen

synthetic peptide corresponding to a region of human MKI67IP with an internal ID of S02402

Physical form

Lyophilized from PBS buffer with 2% sucrose

Price and Availability

Anti-Rabbit 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A0545HRPAnti-Rabbit IgG (whole molecule)-Peroxidase
A3687APAnti-Rabbit IgG (whole molecule)-Alkaline Phosphatase
F0382FITCAnti-Rabbit IgG (whole molecule)-FITC
B8895BiotinAnti-Rabbit IgG (whole molecule)-Biotin





Customers Also Viewed

Anti-KI67, C-Terminal antibody produced in rabbit

~1 mg/mL, affinity isolated antibody, buffered aqueous solution

Anti-MKI67 antibody produced in rabbit

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Anti-MKI67 antibody produced in rabbit

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Monoclonal Anti-MKI67 antibody produced in mouse

clone 7B8, purified immunoglobulin, buffered aqueous solution

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?