• USA Home

  • HPA003396 - Anti-ABCD4 antibody produced in rabbit

Email this page to a friend

HPA003396 Sigma

Anti-ABCD4 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

DOWNLOAD MSDS (PDF)

Synonym: Anti-ATP-binding cassette sub-family D member 4 antibody produced in rabbit Anti-P70R antibody produced in rabbit Anti-PMP69 antibody produced in rabbit Anti-PXMP1-L antibody produced in rabbit Anti-Peroxisomal membrane protein 1-like antibody produced in rabbit Anti-Peroxisomal membrane protein 69 antibody produced in rabbit

icon image

Properties

Related Categories A-AD, A1-AB, Alphabetical Index, Antibodies, Prestige Antibodies,
antibody form   affinity isolated antibody
grade   Prestige Antibodies® Powered by Atlas Antibodies
clone   polyclonal
form   buffered aqueous glycerol solution
species reactivity   human
application(s)   immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  protein array: suitable
immunogen sequence   TLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGQLRETLLDMSLKSQDCEILGESEWGLDTPPGWPAAEPADTAFLLERVSISAPSSDKPLIKDLSLKISEGQSLLITGNTGTGK
shipped in   wet ice
storage temp.   −20°C
Gene Information   Research your gene in Your Favorite Gene powered by Ingenuity
human ... ABCD4(5826)
Show More (12)

Description

Application

Anti-ABCD4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Immunogen

ATP-binding cassette sub-family D member 4 recombinant protein epitope signature tag (PrEST)

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Price and Availability

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?