• USA Home
  • HPA004899 - Anti-BCL6 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA004899 Sigma

Anti-BCL6 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-B-cell lymphoma 6 protein antibody produced in rabbit, Anti-BCL-5 antibody produced in rabbit, Anti-BCL-6 antibody produced in rabbit, Anti-LAZ-3 protein antibody produced in rabbit, Anti-Zinc finger and BTB domain-containing protein 27 antibody produced in rabbit, Anti-Zinc finger protein 51 antibody produced in rabbit

Purchase

Properties

Related Categories AA - CA, Alphabetical Index, Antibodies, Antibodies to Transcription Factors, B,
species reactivity   human
application(s)   immunofluorescence: 1-4 μg/mL
  immunohistochemistry: 1:50- 1:200
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   NIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNS
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... BCL6(604)
biological source   rabbit
availability   not available in USA
conjugate   unconjugated

Description

Immunogen

B-cell lymphoma 6 protein recombinant protein epitope signature tag (PrEST)

General description

BCL6 (B-cell CLL/lymphoma 6) is a nuclear protein, belonging to the BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger) domain family of transcription factors. This zinc finger transcription factor has a molecular mass of 95kDa.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

Anti-BCL6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST86935.

Biochem/physiol Actions

BCL6 (B-cell CLL/lymphoma 6) is mainly involved in the regulation of B lymphocyte development and growth. Bcl6 acts as a diagnostic marker to identify the level of severity of various diseases. It is predominantly expressed in human cancers such as lymphoid malignancy, breast cancer. In breast cancer, it is associated with the proliferation, anchorage-independent growth, migration, and invasion. It is involved in the BCL6 translocation of primary central nervous system lymphoma, which is further linked with apoptosis process. It is a prime gene in B-cell lymphomagenesis. It has been reported that BCL6 may have corealtion with the preeclampsia.

Price and Availability


Antibody Explorer

Explore with Confidence

Amplified Detection
Safety & Documentation

Safety Information

Personal Protective Equipment  Eyeshields, Gloves, half-mask respirator (US), multi-purpose combination respirator cartridge (US)
RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Polyclonals and Monoclonals have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) staining in three to five human cell lines using the pr...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Polyclonals and Monoclonals developed for immunohistochemistry based expression profiling are recommended to use according to the standard IHC staining protocol described below.
Keywords: Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

WB Protocol Revision B, currently used in our P&QC procedures, is an optimized version of the Human Protein Atlas (HPA) original protocol. The HPA original protocol can be found on our website atlasa...
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Polyclonals or Monoclonals are recommended to use according to the standard Prestige Antigen-blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?