Anti-S1PR2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Endothelial differentiation G-protein coupled receptor 5, Anti-S1P receptor Edg-5, Anti-S1P2, Anti-Sphingosine 1-phosphate receptor 2, Anti-Sphingosine 1-phosphate receptor Edg-5

Human Protein Atlas Number HPA014307 Human Protein Atlas characterization data

Properties

Related Categories	Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies to Lipids in Cell Signaling, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary Antibodies, S-SH, S1-SD More...
species reactivity	human
application(s)	immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
	protein array: suitable
clone	polyclonal
antibody form	affinity isolated antibody
form	buffered aqueous glycerol solution
grade	Prestige Antibodies^® Powered by Atlas Antibodies
immunogen sequence	GSLYSEYLNPNKVQEHYNYTKETLETQETTSRQ
shipped in	wet ice
storage temp.	−20°C
Gene Information	human ... S1PR2(9294)

Description

Immunogen

Sphingosine 1-phosphate receptor Edg-5 recombinant protein epitope signature tag (PrEST)

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

Anti-S1PR2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Rabbit 2° Antibody Best Sellers

Prod. No.	Conjugate	Secondary Antibody Description
A0545	HRP	Anti-Rabbit IgG (whole molecule)-Peroxidase
A3687	AP	Anti-Rabbit IgG (whole molecule)-Alkaline Phosphatase
F0382	FITC	Anti-Rabbit IgG (whole molecule)-FITC
B8895	Biotin	Anti-Rabbit IgG (whole molecule)-Biotin

See All Rabbit Secondary Antibodies >

Protocols

Prestige Antibody Immunofluorescence Procedure

A large number of the Prestige Antibodies® have been used in subcellular localization studies by immunofluorescence (IF) staining of three cell lines: A-431, U-2 OS, and U-251MG. Each cell line is st...
Keywords: Immunofluorescence, Immunostaining, Molecular probes, Sample preparations

Prestige Antibody Immunohistochemistry Procedure

The Prestige Antibodies® are subjected to a standardized test procedure using specially designed tissue microarray (TMA) slides.
Keywords: Buffers, Dehydration reaction, Hydration reaction, Immunostaining, Microarray Analysis, PAGE, Tissue microarrays

Prestige Antibody Protein Array Procedure

The binding specificity of the purified Prestige Antibodies® is determined on protein arrays, using PrEST protein fragments, to ensure high specificity toward its antigen and low background binding.
Keywords: Microarray Analysis, Molecular probes

Prestige Antibody Western Blot Procedure

Some Prestige Antibodies® are verified as primary reagents for Western blot analysis using the described procedure.
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

EMAIL THIS PAGE TO A FRIEND

Anti-S1PR2 antibody produced in rabbit