• USA Home
  • HPA026588 - Anti-DNMT3A antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA026588 Sigma

Anti-DNMT3A antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-DNA MTase HsaIIIA, Anti-DNA methyltransferase HsaIIIA, Anti-DNA, Anti-Dnmt3a, Anti-M.HsaIIIA, Anti-cytosine-5

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to Epigenetic Regulators, Antibodies to Most Studied Epigenetic Genes, D,
species reactivity   rat, human, mouse
application(s)   immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect immunofluorescence: suitable
  western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   LPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEE
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... DNMT3A(1788)
biological source   rabbit
conjugate   unconjugated

Description

Immunogen

DNA recombinant protein epitope signature tag (PrEST)

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Linkage

Corresponding Antigen APREST86966.

Price and Availability


Detect Your Unseen Protein

Flow Cytometry Instruments

Antibody Loyalty

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?