• USA Home

  • HPA040735 - Anti-RASSF1 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA040735 Sigma

Anti-RASSF1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-123F2, Anti-NORE2A, Anti-RDA32, Anti-REH3P21, Anti-Ras association (RalGDS/AF-6) domain family member 1

SDS
Anti-RASSF1 antibody produced in rabbit Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
icon image

Properties

Related Categories Alphabetical Index, Antibodies, Prestige Antibodies, Prestige Polyclonal Antibodies, Primary Antibodies,
species reactivity   human
application(s)   immunoblotting: 1:100 - 1:250
  immunohistochemistry: 1:200- 1:500
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   KFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDG
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... RASSF1(11186)
biological source   rabbit
conjugate   unconjugated

Description

Immunogen

Ras association (RalGDS/AF-6) domain family member 1 recombinant protein epitope signature tag (PrEST)

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Linkage

Corresponding Antigen APREST81790.

Price and Availability


Antibody Explorer

Amplified Detection

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?