• USA Home
  • HPA042593 - Anti-DTYMK antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND

HPA042593 Sigma

Anti-DTYMK antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-Deoxythymidylate Kinase (Thymidylate Kinase), Anti-CDC8, Anti-TMPK, Anti-TYMK

Properties

Related Categories Alphabetical Index, Antibodies, D, DQ-DZ, Prestige Antibodies,
species reactivity   human
application(s)   immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   DLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTAT
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... DTYMK(1841)
conjugate   unconjugated

Description

Immunogen

deoxythymidylate kinase (thymidylate kinase) recombinant protein epitope signature tag (PrEST)

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Application

Anti-DTYMK Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Price and Availability


The Human Proteome

2015 Sigma-Aldrich Antibody Calendar

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?