• USA Home
  • HPA067632 - Anti-GABRB2 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
HPA067632 Sigma

Anti-GABRB2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Purchase

Properties

Related Categories AF-AP, Alphabetical Index, Antibodies, G-GC, Prestige Antibodies,
species reactivity   human
application(s)   immunohistochemistry: 1:1000- 1:2500
clone   polyclonal
antibody form   affinity isolated antibody
form   buffered aqueous glycerol solution
isotype   IgG
grade   Prestige Antibodies® Powered by Atlas Antibodies
immunogen sequence   STLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSR
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... GABRB2(2561)
biological source   rabbit
conjugate   unconjugated

Description

Immunogen

gamma-aminobutyric acid (GABA) A receptor, beta 2

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Linkage

Corresponding Antigen APREST88690.

Price and Availability


Antibody Explorer

Explore with Confidence

Amplified Detection
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  1
Protocols & Articles

Protocols

Prestige Antibody® Immunofluorescence Procedure

Prestige Polyclonals and Monoclonals have been used for subcellular localization studies by immunocytochemistry (ICC) - immunofluorescence (IF) staining in three to five human cell lines using the pr...
Keywords: Immunocytochemistry, Immunofluorescence, Immunostaining, Sample preparations

Prestige Antibody® Immunohistochemistry Procedure

Prestige Polyclonals and Monoclonals developed for immunohistochemistry based expression profiling are recommended to use according to the standard IHC staining protocol described below.
Keywords: Dehydration reaction, Gene expression, Hydration reaction, Immunohistochemistry, Immunostaining, Tissue microarrays

Prestige Antibody® Protein Immunoblotting Procedure

WB Protocol Revision B, currently used in our P&QC procedures, is an optimized version of the Human Protein Atlas (HPA) original protocol. The HPA original protocol can be found on our website atlasa...
Keywords: Catalytic combustion detector, Electrophoresis, Gene expression, Sample preparations, Western blot

Prestige Antigens™-Blocking Protocol

Prestige Antigens and the corresponding Prestige Polyclonals or Monoclonals are recommended to use according to the standard Prestige Antigen-blocking protocol described below.
Keywords: Immunocytochemistry, Immunohistochemistry, Immunostaining, Titrations, Western blot

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?