• USA Home
  • M1882 - Myoglobin from equine heart

EMAIL THIS PAGE TO A FRIEND
M1882 Sigma

Myoglobin from equine heart

≥90% (SDS-PAGE), essentially salt-free, lyophilized powder

Synonym: Myoglobin from horse heart

Purchase

Properties

Related Categories Biochemicals and Reagents, Coagulation Proteins and Reagents, Plasma & Blood Proteins, Proteins and Derivatives
assay   ≥90% (SDS-PAGE)
form   essentially salt-free, lyophilized powder
Iron content   ≥0.20%
storage temp.   −20°C

Description

Frequently Asked Questions

Frequently Asked Questions are available for this Product.

Packaging

1, 5, 10 g in glass bottle

250 mg in glass bottle

Biochem/physiol Actions

Myoglobin is a mobile carrier of oxygen that is developed in red muscle and heart cells. This happens as a response to elevated demand for oxygen during exercise, and transports oxygen from the sarcolemma to the mitochondria of vertebrate heart and red muscle cells.

Price and Availability


Laboratory Gloves
Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

Certificate of Origin

Frequently Asked Questions

Which document(s) contains shelf-life or expiration date information for a given product?
If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis. These documents are located on the product detail page under Useful Links & Tools. Click on the following link to search for a Certificate of Analysis. Please click the following link to see the details on our Product Dating Information.
How do I get lot-specific information or a Certificate of Analysis?
A Certificate of Analysis is available by lot number and can be obtained through our Advanced Search Option: http://www.sigmaaldrich.com/catalog/AdvancedSearchPage.do
What is the molecular weight of Product M1882, Myoglobin from equine heart?
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Is Product M1882, Myoglobin from equine heart, oxidized?
Yes, it is oxidized.
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Which has more affinity for oxygen, hemoglobin or myoglobin?
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
How do I find price and availability?
There are several ways to find pricing and availability for our products.  Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote.  USA customers:  1-800-325-3010 or view local office numbers. 
What is the Department of Transportation shipping information for this product?
Transportation information can be found in Section 14 of the product's (M)SDS. To access the shipping information for this material, use the link on the product detail page for the product, or search here. 
My question is not addressed here, how can I contact Technical Service for assistance?
Use the option to the right to "Ask a Question" by email of a Technical Service Scientist.
Do you have the sequence for Product M1882, Myoglobin from equine heart?
Product M1882 - Myoglobin from equine heart is purified from equine heart.  It is not sequenced. Accession P68082 for equine myoglobin has the following sequence MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH PGDFGADAQGAMTKALELFRNDIAAKYKELGFQG I hope that you find this information helpful. If you have further questions, please reply to this email. Sincerely, Audrey Fleming Sigma-Aldrich Technical Service
Show more questions
Protocols & Articles

Articles

HPLC Analysis of Four Proteins on Zenix® SEC-300, Comparison of Column Internal Diameter

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Four Proteins on Zenix® SEC-300, Comparison of Column Internal Diameter
Keywords: Chromatography, High performance liquid chromatography, Size-exclusion chromatography

HPLC Analysis of Protein Standards by Size Exclusion on Zenix® as Affected by Pore Size: 100Å vs. 300Å

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Protein Standards by Size Exclusion on Zenix® as Affected by Pore Size: 100Å vs. 300Å
Keywords: Chromatography, High performance liquid chromatography, Size-exclusion chromatography

HPLC Analysis of Protein Standards on Zenix® SEC-300 at Low Flow Rate

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Protein Standards on Zenix® SEC-300 at Low Flow Rate
Keywords: Chromatography, Diffusion, High performance liquid chromatography, Size-exclusion chromatography

HPLC Analysis of Protein Standards on Zenix® SEC-300 by Size Exclusion As Affected by Arginine

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Protein Standards on Zenix® SEC-300 by Size Exclusion As Affected by Arginine
Keywords: Chromatography, High performance liquid chromatography, Size-exclusion chromatography

HPLC Analysis of Protein Standards on Zenix® SEC-300 by Size Exclusion As Affected by Potassium Chloride

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Protein Standards on Zenix® SEC-300 by Size Exclusion As Affected by Potassium Chloride
Keywords: Chromatography, High performance liquid chromatography, Size-exclusion chromatography

HPLC Analysis of Protein Standards on Zenix® SEC-300 by Size Exclusion As Affected by Sodium Perchlorate

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Protein Standards on Zenix® SEC-300 by Size Exclusion As Affected by Sodium Perchlorate
Keywords: Chromatography, High performance liquid chromatography, Size-exclusion chromatography

HPLC Analysis of Protein Standards on Zenix® SEC-300 in the Presence of a Denaturant

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Protein Standards on Zenix® SEC-300 in the Presence of a Denaturant
Keywords: Chromatography, High performance liquid chromatography, Size-exclusion chromatography

HPLC Analysis of Protein Standards on Zenix® SEC-300 using Different Buffer Systems

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Protein Standards on Zenix® SEC-300 using Different Buffer Systems
Keywords: Chromatography, High performance liquid chromatography, Size-exclusion chromatography

HPLC Analysis of Proteins on Discovery® BIO PolyMA-WAX (Analyte Set #1)

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Proteins on Discovery® BIO PolyMA-WAX (Analyte Set #1)
Keywords: Chromatography, High performance liquid chromatography, Separation

HPLC Analysis of Proteins on TSKgel® Porous (Phenyl-5PW and Ether-5PW) and Non-Porous (Butyl-NPR) HIC Columns

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Proteins on TSKgel® Porous (Phenyl-5PW and Ether-5PW) and Non-Porous (Butyl-NPR) HIC Columns
Keywords: Chromatography, High performance liquid chromatography

HPLC Analysis of Proteins on Zenix® SEC-300, 30 cm x 4.6 mm I.D., 3 μm

From our library of Articles, Sigma-Aldrich presents HPLC Analysis of Proteins on Zenix® SEC-300, 30 cm x 4.6 mm I.D., 3 μm
Keywords: Chromatography, High performance liquid chromatography, Separation, Size-exclusion chromatography

Protein Molecular Weight Calibration Curve on Zenix® Size Exclusion Columns, Effect of Pore Size

From our library of Articles, Sigma-Aldrich presents Protein Molecular Weight Calibration Curve on Zenix® Size Exclusion Columns, Effect of Pore Size
Keywords: Chromatography, High performance liquid chromatography, Size-exclusion chromatography

Scalability of TSKgel® Phenyl-5PW Analytical HPLC Separations to Preparative/Process Scale on Toyopearl® Phenyl-650M Resins

From our library of Articles, Sigma-Aldrich presents Scalability of TSKgel® Phenyl-5PW Analytical HPLC Separations to Preparative/Process Scale on Toyopearl® Phenyl-650M Resins
Keywords: Chromatography, High performance liquid chromatography

Peer-Reviewed Papers
15

References

Related Products

related product

Product #

Description

Add to Cart

92210 Timestrip Plus 0 °C
06693 Timestrip Plus -20 °C

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?