• USA Home
  • QPREST33261 - SILuPrEST TFG

EMAIL THIS PAGE TO A FRIEND
QPREST33261 Sigma

SILuPrEST TFG

SILuPrESTs Powered by Atlas Antibodies, buffered aqueous solution

Synonym: TRK-fused gene protein

Purchase

Properties

Related Categories Mass Spectrometry, Molecular Biology, Proteomics, SILuPrEST Mass Spectrometry Standards, SILuPrEST S - T More...
recombinant   expressed in E. coli LysA ArgA BL21(DE3)
assay   >80% (SDS-PAGE)
form   buffered aqueous solution
mol wt   predicted mol wt 28kDa including tags
purified by   immobilized metal affinity chromatography (IMAC)
packaging   pkg of 1nmol × 5 vials
concentration   (Lot specific concentration determined by ESI-MS/MS using highly pure and amino acid analyzed His6ABP as internal standard for targeted quantification of the labeled His6ABP-containing SILuPrEST will be stated on the Certificate of Analysis)
immunogen sequence   LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS
UniProt accession no.   Q92734
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... TFG(10342)

Description

Analysis Note

Isotopic Label Incorporation

The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.

A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G.

All SILuPrESTs contain an N-terminal His6ABP fusion tag, used for accurate determination of concentration. The fusion tag sequence is:

GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.

The specific human protein sequence begins directly after ′VDKLAAA′.

Application

Internal standard in MS-based quantitative proteomics

General description

Lys, Arg 13C and 15N metabolically labeled recombinant human protein fragment

Preparation Note

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com

SILu is a trademark of Sigma-Aldrich Co. LLC

Physical form

Heavy proteins are provided in solution of 1M Urea PBS, pH 7.4

Price and Availability

Safety & Documentation

Safety Information

RIDADR 
NONH for all modes of transport
WGK Germany 
3

Documents

Certificate of Analysis

Protocols & Articles
Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?