• USA Home
  • SAB1400138 - Anti-IL3 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB1400138 Sigma

Anti-IL3 antibody produced in rabbit

IgG fraction of antiserum, buffered aqueous solution

Synonym: Anti-IL-3, Anti-MCGF, Anti-MGC79398, Anti-MGC79399, Anti-MULTI-CSF

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies to Cytokines and Growth Factors, Antibodies to Interleukins (IL),
species reactivity   human
application(s)   capture ELISA: suitable
  western blot: suitable
clone   polyclonal
antibody form   IgG fraction of antiserum
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... IL3(3562)
biological source   rabbit
conjugate   unconjugated

Description

Immunogen

IL3 (AAH69472.1, 1 a.a. ~ 152 a.a) full-length human protein.

Sequence
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

General description

The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?