• USA Home
  • SAB1400142 - Monoclonal Anti-IL15 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1400142 Sigma

Monoclonal Anti-IL15 antibody produced in mouse

clone 1G3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-IL15, Anti-MGC9721

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies to Cytokines and Growth Factors, Antibodies to Interleukins (IL),
species reactivity   human
application(s)   indirect ELISA: suitable
clone   1G3, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG2bκ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... IL15(3600)
biological source   mouse
conjugate   unconjugated

Description

Immunogen

IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein.

Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

General description

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other′s activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

Interleukin-15 (IL-15) stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. It exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells. On binding to its receptor, IL-15 is indirectly involved in activating proto-oncogenes. Increased expression of IL-15 has been implicated with rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis and diseases affiliated with retroviruses like human immunodeficiency virus (HIV) and human T-lymphotropic virus-1 (HTLV-I).

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?