• USA Home
  • SAB1400357 - Anti-HS2ST1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1400357 Sigma

Anti-HS2ST1 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Synonym: Anti-FLJ11317, Anti-KIAA0448, Anti-MGC131986, Anti-dJ604K5.2

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, HP-HT, Primary Antibodies
species reactivity   human
application(s)   capture ELISA: suitable
  western blot: suitable
clone   polyclonal
antibody form   IgG fraction of antiserum
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... HS2ST1(9653)
biological source   mouse
conjugate   unconjugated

Description

Immunogen

HS2ST1 (AAH25990.1, 1 a.a. ~ 229 a.a) full-length human protein.

Sequence
MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW

General description

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?