• USA Home
  • SAB1400451 - Monoclonal Anti-AGTPBP1 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1400451 Sigma

Monoclonal Anti-AGTPBP1 antibody produced in mouse

clone 2B9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DKFZp686M20191, Anti-KIAA1035, Anti-NNA1

Purchase

Properties

Related Categories AE-AK, Alphabetical Index, Antibodies, Primary Antibodies
species reactivity   human
application(s)   indirect ELISA: suitable
  western blot: suitable
clone   2B9, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG1κ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... AGTPBP1(23287)
biological source   mouse
conjugate   unconjugated

Description

Immunogen

AGTPBP1 (NP_056054, 1087 a.a. ~ 1186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP

General description

NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.[supplied by OMIM

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?