• USA Home
  • SAB1400496 - Anti-PSCD4 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1400496 Sigma

Anti-PSCD4 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Synonym: Anti-CYT4, Anti-DJ63G5.1

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, PS-PS, Primary Antibodies
species reactivity   human
application(s)   capture ELISA: suitable
  western blot: suitable
clone   polyclonal
antibody form   IgG fraction of antiserum
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... PSCD4(27128)
biological source   mouse
conjugate   unconjugated

Description

Immunogen

CYTH4 (NP_037517.1, 1 a.a. ~ 394 a.a) full-length human protein.

Sequence
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ

General description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The structures of this gene and CYTH1 are very similar. (provided by RefSeq)

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?