• USA Home
  • SAB1400764 - Anti-ZNF502 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1400764 Sigma

Anti-ZNF502 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Synonym: Anti-FLJ12515, Anti-FLJ14855

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, ZNF4-ZNR
species reactivity   human
application(s)   capture ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: suitable
clone   polyclonal
antibody form   IgG fraction of antiserum
form   buffered aqueous solution
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... ZNF502(91392)
biological source   mouse
conjugate   unconjugated

Description

Immunogen

ZNF502 (NP_149987.2, 1 a.a. ~ 544 a.a) full-length human protein.

Sequence
MLNMQGAEERDIRRETCPGWVNKNKPALEQDVCKIDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFGRITFIHKEAPPEIISQGYNFEKSLLLTSSLVTRLRVSTEESLHQWETSNIQTNDISDQSKCPTLCTQKKSWKCNECGKTFTQSSSLTQHQRTHTGERPYTCEECGKAFSRSSFLVQHQRIHTGVKPYGCEQCGKTFRCRSFLTQHQRIHTGEKPYKCNECGNSFRNHSHLTEHQRIHTGEKPYKCNRCGKAFNQNTHLIHHQRIHTGEKPYICSECGSSFRKHSNLTQHQRIHTGEKPHKCDECGKTFQTKANLSQHQRIHSGEKPYKCKECGKAFCQSPSLIKHQRIHTGEKPYKCKECGKAFTQSTPLTKHQRIHTGERPYKCSECGKAFIQSICLIRHQRSHTGEKPYKCNECGKGFNQNTCLTQHMRIHTGEKPYKCKECGKAFAHSSSLTEHHRTHTGEKLYKCSECEKTFRKYAHLSEHYRIHTGEKPYECIECGKFFRHSSVLFRHQKLHSGD

General description

The gene ZNF502 (zinc finger protein 502) is mapped to human chromosome 3p. The encoded protein localizes in the nucleus.

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

ZNF502 (zinc finger protein 502) is a transcription factor. It interacts with the respiratory syncytial virus (RSV) matrix protein and knockdown of ZNF502 causes reduced RSV virus production in infected cells.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?