• USA Home
  • SAB1400832 - Monoclonal Anti-CITED4 antibody produced in mouse

EMAIL THIS PAGE TO A FRIEND
SAB1400832 Sigma

Monoclonal Anti-CITED4 antibody produced in mouse

clone 4F6, purified immunoglobulin, buffered aqueous solution

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Chromatin Remodeling, Antibodies in Chromatin Remodeling, CI-CN,
species reactivity   human
application(s)   immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: suitable
clone   4F6, monoclonal
antibody form   purified immunoglobulin
form   buffered aqueous solution
isotype   IgG2aκ
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... CITED4(163732)
biological source   mouse
conjugate   unconjugated

Description

Immunogen

CITED4 (NP_597724.1, 131 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC

General description

CITED4 belongs to a family of transcriptional coactivators that bind several proteins, including CREB-binding protein (MIM 600140) and p300 (MIM 602700).[supplied by OMIM

Physical form

Solution in phosphate buffered saline, pH 7.4

Features and Benefits

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Inflammation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?