SAB1406122 Sigma

Anti-MGMT antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

DOWNLOAD MSDS (PDF)

Properties

Related Categories Alphabetical Index, Antibodies, MF-MN, Primary Antibodies
species reactivity   human
application(s)   indirect immunofluorescence: suitable
  western blot: suitable
concentration   ~0.45 mg/mL
antibody form   purified immunoglobulin
form   buffered aqueous solution
immunogen sequence   MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
mol wt   antigen mol wt ~21.6 kDa
shipped in   dry ice
storage temp.   −20°C
Gene Information   human ... MGMT(4255)
NCBI accession no.   NM_002412.2

Description

Immunogen

MGMT (NP_002403.1, 1 a.a. ~ 207 a.a) full-length human protein.

General description

Mouse polyclonal antibody raised against a full-length human MGMT protein.

Physical form

Clear, colorless solution in phosphate buffered saline, pH 7.2

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Mouse 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A4416HRPAnti-Mouse IgG (whole molecule)-Peroxidase
A3562APAnti-Mouse IgG (whole molecule)-Alkaline Phosphatase
F0257FITCAnti-Mouse IgG (whole molecule)-FITC
B7264BiotinAnti-Mouse IgG (whole molecule)-Biotin





Customers Also Viewed

clone MGMT-214, purified immunoglobulin, buffered aqueous solution

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?