SAB2102042 Sigma

Anti-RORB antibody produced in rabbit

affinity isolated antibody, lyophilized powder

DOWNLOAD MSDS (PDF)

Synonym: Anti-BA133M9.1, Anti-NR1F2, Anti-RAR-related orphan receptor B, Anti-ROR-β, Anti-RZRB

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies to Transcription Factors, Epigenetics, Primary Antibodies,
species reactivity   human, mouse, rat
application(s)   western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   lyophilized powder
immunogen sequence   IQKNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPL
storage temp.   −20°C
Gene Information   human ... RORB(6096)

Description

Immunogen

Peptide region of the protein sequence according to NP_008845.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Rabbit 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A0545HRPAnti-Rabbit IgG (whole molecule)-Peroxidase
A3687APAnti-Rabbit IgG (whole molecule)-Alkaline Phosphatase
F0382FITCAnti-Rabbit IgG (whole molecule)-FITC
B8895BiotinAnti-Rabbit IgG (whole molecule)-Biotin





Customers Also Viewed

Anti-RORB antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Monoclonal Anti-RORB antibody produced in mouse

clone 4B4, purified immunoglobulin, buffered aqueous solution

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?