SAB2102352 Sigma

Anti-SYP antibody produced in rabbit

affinity isolated antibody, lyophilized powder

DOWNLOAD MSDS (PDF)

Synonym: Anti-Synaptophysin

Properties

Related Categories Alphabetical Index, Antibodies, Antibodies for Neurobiology, Antibodies to Neural Proteins, Antibodies to Synaptic Proteins,
species reactivity   , zebrafish, bovine, human, mouse, rat
application(s)   western blot: suitable
clone   polyclonal
antibody form   affinity isolated antibody
form   lyophilized powder
immunogen sequence   MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
storage temp.   −20°C
Gene Information   human ... SYP(6855)

Description

Immunogen

Peptide region of the protein sequence according to NP_003170.

Physical form

Lyophilized from PBS buffer with 2% sucrose

Price and Availability

Anti-Rabbit 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A0545HRPAnti-Rabbit IgG (whole molecule)-Peroxidase
A3687APAnti-Rabbit IgG (whole molecule)-Alkaline Phosphatase
F0382FITCAnti-Rabbit IgG (whole molecule)-FITC
B8895BiotinAnti-Rabbit IgG (whole molecule)-Biotin





Customers Also Viewed

Anti-Synaptophysin antibody produced in rabbit

~1 mg/mL, affinity isolated antibody, buffered aqueous solution

Anti-SYP antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Monoclonal Anti-SYP antibody produced in mouse

clone 3B3, purified immunoglobulin, buffered aqueous solution

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?