• USA Home
  • SAB2103386 - Anti-APBB2 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2103386 Sigma

Anti-APBB2 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-FE65L1, Anti-FE65L, Anti-MGC35575

Purchase

Properties

Related Categories AO-AQ, Alphabetical Index, Antibodies, Primary Antibodies
species reactivity   rabbit, horse, rat, bovine, canine, guinea pig, human, mouse
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 81 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... APBB2(323)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_173075

Description

Immunogen

The immunogen for anti-APBB2 antibody: synthetic peptide derected towards the middle region of human APBB2

General description

The gene APBB2 (amyloid β precursor protein binding family B member 2) is mapped to human chromosome 4p13.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

The gene APBB2 (amyloid β precursor protein binding family B member 2), also referred to as FE65-like 1, encodes an adaptor protein that binds to the cytoplasmic domain of β-amyloid precursor protein (βAPP) and processes it to form β-amyloid (Aß). Over-expression of APBB2 leads to an accumulation of Aβ in senile plaques seen in patients with Alzheimer′s disease (AD). Mutations in this gene have been associated with AD.

Sequence

Synthetic peptide located within the following region: QNLAPSDEESSWTTLSQDSASPSSPDETDIWSDHSFQTDPDLPPGWKRVS

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?