• USA Home
  • SAB2103410 - Anti-GNB2L1, (N-terminal) antibody produced in rabbit

SAB2103410 Sigma

Anti-GNB2L1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-Gnb2-rs1, Anti-HLC-7, Anti-PIG21, Anti-RACK1



Related Categories Alphabetical Index, Antibodies, GM-GO, Primary Antibodies
species reactivity   mouse, rat, human, rabbit, sheep, rabbit, guinea pig, zebrafish, pig,
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 35 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... GNB2L1(10399)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_006098



The immunogen for anti-GNB2L1 antibody: synthetic peptide derected towards the N terminal of human GNB2L1

General description

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a stably expressed housekeeping gene expressed in alveolar macrophage and neutrophils. The gene has been hypothesized to encode a protein RACK1 (Receptor for activated C kinase 1). It is mapped on the telomeric position of chromosome 5q35.3.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Anti-GNB2L1, (N-terminal) antibody produced in rabbit is suitable for western blot analysis.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a scaffold protein highly involved in the binding and anchorage of protein kinase C. It has been hypothesized that GNB2L1 may act as a regulatory cofactor of multidrug resistance protein 3 (MDR3/ABCB4) and is vital for the plasma membrane localization and for mediating the translocation function of ABCB4.


Synthetic peptide located within the following region: ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQI

Price and Availability

Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?