• USA Home
  • SAB2103411 - Anti-SR140, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2103411 Sigma

Anti-SR140, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-KIAA0332, Anti-MGC133197

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, SP-SS
species reactivity   rabbit, mouse, canine, bovine, human, rat, horse
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 118 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... SR140(23350)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_001080415

Description

Immunogen

The immunogen for anti-SR140 antibody: synthetic peptide derected towards the N terminal of human SR140

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Sequence

Synthetic peptide located within the following region: NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?