• USA Home
  • SAB2103784 - Anti-PHF21A, (N-terminal) antibody produced in rabbit

SAB2103784 Sigma

Anti-PHF21A, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-BHC80, Anti-BM-006, Anti-KIAA1696



Related Categories Alphabetical Index, Antibodies, PH-PI, Primary Antibodies
species reactivity   mouse, rat, human, rabbit, zebrafish, guinea pig
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 70 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PHF21A(51317)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_016621



The immunogen for anti-PHF21A antibody: synthetic peptide derected towards the N terminal of human PHF21A

General description

The gene PHF21A (PHD finger protein 21A) is mapped to human chromosome 11p11.2.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

The gene PHF21A (PHD finger protein 21A) is also referred to as BHC80 and forms a component of the BRAF-histone deacetylase complex, which is involved in the repression of target-gene transcription. The encoded protein is found to be essential for normal brain development and cognitive function. Disruption of this gene has been found to be associated with developmental delay and craniofacial anomalies that are seen in patients with Potocki–Shaffer syndrome (PSS).


Synthetic peptide located within the following region: MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK

Price and Availability

Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?