• USA Home
  • SAB2103795 - Anti-SLC19A3 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2103795 Sigma

Anti-SLC19A3 antibody produced in rabbit

affinity isolated antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, SLA-SLC2
species reactivity   guinea pig, human, rabbit, canine, bovine, mouse, rat, horse
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
mol wt   mol wt 56 kDa
storage temp.   −20°C
Gene Information   human ... SLC19A3(80704)
biological source   rabbit
packaging   pkg of 100 μL buffered aqueous solution
  pkg of 50 μg lyophilized powder
conjugate   unconjugated
NCBI accession no.   NM_025243

Description

Immunogen

The immunogen for anti-SLC19A3 antibody: synthetic peptide derected towards the middle region of human SLC19A3

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Sequence

Synthetic peptide located within the following region: FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?