• USA Home
  • SAB2103830 - Anti-XPO5 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2103830 Sigma

Anti-XPO5 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-FLJ14239, Anti-FLJ32057, Anti-FLJ45606, Anti-KIAA1291

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, X
species reactivity   rat, mouse, rabbit, human, guinea pig, horse
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 136 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... XPO5(57510)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_020750

Description

Immunogen

The immunogen for anti-XPO5 antibody: synthetic peptide derected towards the middle region of human XPO5

General description

XPO5 (exportin 5) is a Ran-GTP-dependent nuclear transport protein for double-stranded RNA binding proteins. It belongs to the karyopherin protein family which is involved in nucleus to cytoplasm transport of specific classes of small RNAs.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

XPO5 (exportin 5) is responsible for the translocation of miRNA (micro-RNA) precursor from nucleus to cytoplasm. Studies in HeLa cells show that miR-138 lowers the stability of XPO5 protein, thus, decreasing miRNA processing. This protein is also involved in the transport of short hairpin (shRNA). It docks on the nuclear pore complex and transports three classes of RNAs, tRNA, Y-RNA and miRNA precursors, across the nuclear membrane, in a RanGTP-RanGDP gradient-dependent manner.

Sequence

Synthetic peptide located within the following region: MEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGE

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?