• USA Home
  • SAB2103902 - Anti-PLAGL1, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2103902 Sigma

Anti-PLAGL1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-DKFZp781P1017, Anti-LOT1, Anti-MGC126275, Anti-MGC126276, Anti-ZAC

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, PJ-PN, Primary Antibodies
species reactivity   bovine, guinea pig, rabbit, rat, human, mouse, canine, pig
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 51 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PLAGL1(5325)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_006718

Description

Immunogen

The immunogen for anti-PLAGL1 antibody: synthetic peptide derected towards the N terminal of human PLAGL1

General description

The gene PLAGL1 (pleiomorphic adenoma-like protein 1), PLAGL2 and PLAG1 form a subfamily of PLAG family of zinc finger proteins that recognize DNA and RNA. The three members share similarity at the amino-terminal, but are functionally different, varying in their DNA binding capacities. The gene is mapped to human chromosome 6q24.2, a region implicated in several cancers.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

The maternally-imprinted gene, PLAGL1 (pleiomorphic adenoma-like protein 1), functions as an oncogene as well as a tumor suppressor depending on the cell context. It has been found to exhibit anti-proliferative properties and regulate apoptosis and cell-cycle arrest via p53.

Sequence

Synthetic peptide located within the following region: FNRKDHLKNHLQTHDPNKMAFGCEECGKKYNTMLGYKRHLALHAASSGDL

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?