SAB2103911 Sigma

Anti-TH, (N-terminal) antibody produced in rabbit

~1 mg/mL, affinity isolated antibody, lyophilized powder

DOWNLOAD MSDS (PDF)

Synonym: Anti-TYH

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, TF-TJ
species reactivity   human
application(s)   western blot: suitable
clone   polyclonal
concentration   ~1 mg/mL
antibody form   affinity isolated antibody
form   lyophilized powder
immunogen sequence   GAPGPSLTGSPWPGTAAPAASYTPTPRSPRFIGRRQSLIEDARKEREAAV
mol wt   antigen mol wt ~41 kDa
storage temp.   −20°C
Gene Information   human ... TH(7054)
NCBI accession no.   NM_199292

Description

Immunogen

Peptide region of the protein sequence according to NP_954986.

Physical form

Antibody is lyophilized from PBS buffer with 2% sucrose.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Price and Availability

Anti-Rabbit 2° Antibody Best Sellers


Prod. No.ConjugateSecondary Antibody Description
A0545HRPAnti-Rabbit IgG (whole molecule)-Peroxidase
A3687APAnti-Rabbit IgG (whole molecule)-Alkaline Phosphatase
F0382FITCAnti-Rabbit IgG (whole molecule)-FITC
B8895BiotinAnti-Rabbit IgG (whole molecule)-Biotin





Customers Also Viewed

Anti-Th (Ab-31) antibody produced in rabbit

affinity isolated antibody

Anti-TH (C-terminal) antibody produced in goat

affinity isolated antibody, buffered aqueous solution

Anti-TH, (N-terminal) antibody produced in rabbit

~1 mg/mL, affinity isolated antibody, lyophilized powder

affinity isolated antibody, buffered aqueous glycerol solution, sufficient for 10 blots

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?