• USA Home
  • SAB2104086 - Anti-KIF9, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2104086 Sigma

Anti-KIF9, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-MGC104186

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, KIA-KIT, Primary Antibodies
species reactivity   guinea pig, mouse, rabbit, horse, rat, human, canine, bovine
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 90 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... KIF9(64147)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_182902

Description

Immunogen

The immunogen for anti-KIF9 antibody: synthetic peptide derected towards the N terminal of human KIF9

General description

KIF9 (Kinesin family member 9) is a microtubule-associated protein belonging to the kinesin 9 motor family. It is localized in the mitotic spindle.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Application

Anti-KIF9, (N-terminal) antibody produced in rabbit is suitable for western blot analysis.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

KIF9 (Kinesin family member 9) is involved in the regulation of spindle dynamics In terms of chromosome organization, spindle length control, and mitotic progression. It forms a complex by binding to the GEM, a small GTP-binding protein, in mitotic cells and the complex controls spindle length. It also retards microtubule growth. In primary macrophage of humans, KIF9 controls morphology and numbers of the podosomes and its ability to degrade matrix material.

Sequence

Synthetic peptide located within the following region: MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?