• USA Home
  • SAB2104114 - Anti-NRARP antibody produced in rabbit

SAB2104114 Sigma

Anti-NRARP antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-MGC61598



Related Categories Alphabetical Index, Antibodies, NK-NR, Primary Antibodies
species reactivity   zebrafish, mouse, human, canine, rat
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 12 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... NRARP(441478)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_001004354



The immunogen for anti-NRARP antibody: synthetic peptide derected towards the middle region of human NRARP

General description

NRARP (NOTCH-regulated ankyrin repeat protein) works as a negative feedback regulator in Notch (neurogenic locus notch homolog protein) signaling. On the other hand, expression of NRARP is controlled by Notch protein. The protein has two ankyrin repeats.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

During development, NRARP (NOTCH-regulated ankyrin repeat protein) is involved in crosstalk between NOTCH (neurogenic locus notch homolog protein) and WNT (wingless-type mouse mammary tumor virus integration site) signaling. Presence of NRARP allows proper vessel density in angiogenesis. In breast cancer, NRARP might enhances the cell proliferation. It is upregulated in thyroid cancer tissues and is associated with cell growth and invasion. It is also overexpressed in hepatocellular carcinoma tumor tissues.


Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Price and Availability

Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?