• USA Home
  • SAB2104125 - Anti-CDK7 antibody produced in rabbit

SAB2104125 Sigma

Anti-CDK7 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-CAK1, Anti-CDKN7, Anti-MO15, Anti-STK1, Anti-p39MO15



Related Categories Alphabetical Index, Antibodies, CDH-CDY, Primary Antibodies
species reactivity   pig, rat, bovine, horse, canine, guinea pig, human
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 39 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... CDK7(1022)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_001799



The immunogen for anti-CDK7 antibody: synthetic peptide derected towards the middle region of human CDK7

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.


Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE

Price and Availability

Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers


Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?