• USA Home
  • SAB2104140 - Anti-CBLL1, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2104140 Sigma

Anti-CBLL1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-FLJ23109, Anti-HAKAI, Anti-MGC163401, Anti-MGC163403, Anti-RNF188

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, CAM-CB, Primary Antibodies
species reactivity   rat, mouse, horse, human, rabbit, guinea pig
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 55 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... CBLL1(79872)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_024814

Description

Immunogen

The immunogen for anti-CBLL1 antibody: synthetic peptide derected towards the N terminal of human CBLL1

General description

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is a cbl-like ubiquitin ligase of E-cadherin complex. It is expressed in the neurons of central nervous system.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Application

Anti-CBLL1, (N-terminal) antibody produced in rabbit is suitable for western blot analysis.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is an E-cadherin binding protein involved in the ubiquitination of E-cadherin and regulation of E-cadherin complex endocytosis. During ubiquitination, it directly binds to the cytoplasmic domain of E-cadherin. It has been reported in a study that CBLL1 may play a role in neuronal apoptosis and in LPS (Lipopolysaccharide) administration. CBLL1 have also been predicted as a regulator of cell proliferation.

Sequence

Synthetic peptide located within the following region: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?