• USA Home
  • SAB2104152 - Anti-TRIM50 antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2104152 Sigma

Anti-TRIM50 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-FLJ32804, Anti-MGC138357, Anti-MGC138359, Anti-TRIM50A

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, TR-TR
species reactivity   guinea pig, bovine, human, rat, canine, pig, mouse, horse, rabbit
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 55 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... TRIM50(135892)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_178125

Description

Immunogen

The immunogen for anti-TRIM50 antibody: synthetic peptide derected towards the middle region of human TRIM50

General description

TRIM50 (Tripartite motif containing 50) is an E3 ubiquitin ligase belonging to the TRIpartite motif gene family. It is mapped to chromosome 7q11.23. It is expressed in gastric parietal cells, intestine, liver, brain and is localized mainly in the tubulovesicular and canalicular membranes.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Application

Anti-TRIM50 antibody produced in rabbit is suitable for western blot.

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Biochem/physiol Actions

TRIM50 (Tripartite motif containing 50) is involved in the ubiquitination pathway. Its RING domain directly conjugates with E2 ubiquitin proving its ability to act as an E3 ubiquitin ligase. TRIM50 plays a major role in the organization of tubulovesicular structure in cytoskeleton network by forming canaliculi and microvilli in parietal cells. It can identify the phosphorylated state of phosphoinositol lipids. Study shows the association of TRIM50 with the Williams-Beuren syndrome (WBS), a neurodevelopmental and multisystemic disease. It has been reported in the study that the ubiquitin-mediated proteasome pathway mediated by TRIM50 might be involved in the WBS phenotype.

Sequence

Synthetic peptide located within the following region: AEMPQARPLEGAFSPISFKPGLHQADIKLTVWKRLFRKVLPAPEPLKLDP

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?