• USA Home
  • SAB2104246 - Anti-KCNH6 antibody produced in rabbit

SAB2104246 Sigma

Anti-KCNH6 antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-ERG2, Anti-HERG2



Related Categories Alphabetical Index, Antibodies, K-KH, Primary Antibodies
species reactivity   bovine, horse, rat, rabbit, human, mouse, canine
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 100 kDa
storage temp.   −20°C
Gene Information   human ... KCNH6(81033)
biological source   rabbit
packaging   pkg of 100 μL buffered aqueous solution
  pkg of 50 μg lyophilized powder
conjugate   unconjugated
NCBI accession no.   NM_173092



The immunogen for anti-KCNH6 antibody: synthetic peptide derected towards the middle region of human KCNH6

Features and Benefits

Antibody Bioguarantee
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.


Synthetic peptide located within the following region: PLASPLHPLEVQGLICGPCFSSLPEHLGSVPKQLDFQRHGSDPGFAGSWG

Price and Availability

Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?