• USA Home
  • SAB2105004 - Anti-PRKAB1, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2105004 Sigma

Anti-PRKAB1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-AMPK, Anti-HAMPKb, Anti-MGC17785

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, PR-PR, Primary Antibodies
species reactivity   rabbit, mouse, human, guinea pig, horse
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 30 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... PRKAB1(5564)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_006253

Description

Immunogen

The immunogen for anti-PRKAB1 antibody: synthetic peptide derected towards the N terminal of human PRKAB1

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Application

Anti-PRKAB1, (N-terminal) antibody produced in rabbit is suitable for western blot analysis.

Biochem/physiol Actions

PRKAB1 (protein kinase, AMP-activated, β 1 non-catalytic subunit) is a non-catalytic, β subunit of AMP-activated protein kinase (AMPK). It acts as a metabolic sensor for AMP levels. It plays a key role in energy sensor during the response to energy demand and supply. It regulates cell metabolism. It increases the glycolytic flux by H202 which increase intracellular NADPH content. The activity of PRKAB1 is controlled by decreasing concentrations of adenosine triphosphate (ATP) and increasing AMP concentrations.

Sequence

Synthetic peptide located within the following region: KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?