• USA Home
  • SAB2105015 - Anti-VPS28, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2105015 Sigma

Anti-VPS28, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-MGC60323

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, Primary Antibodies, V
species reactivity   human, guinea pig, horse, rabbit, mouse, rat
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 25 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... VPS28(51160)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_016208

Description

Immunogen

The immunogen for anti-VPS28 antibody: synthetic peptide derected towards the N terminal of human VPS28

General description

The gene VPS28 (vacuolar protein sorting-associated protein 28 homolog) is mapped to human chromosome 8q24.3. The encoded protein is part of the ESCRT-1 (endosomal complexes required for transport) complex. The complex participates in membrane remodelling, including multivesicular body biogenesis and cytokinesis.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Biochem/physiol Actions

VPS28 (vacuolar protein sorting-associated protein 28 homolog) participates in various cellular events, including OGD/R (oxygen and glucose deprivation followed by reoxygenation)-mediated neuronal cell death, peptide growth factors-initiated SOS1 (son of sevenless 1)-Ras signaling, epithelial-mesenchymal transition and cell invasion.

Sequence

Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?