• USA Home
  • SAB2105026 - Anti-KL, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2105026 Sigma

Anti-KL, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, KL-KY, Primary Antibodies
species reactivity   human
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 60 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... KL(9365)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   BAA24941

Description

Immunogen

The immunogen for anti-KL antibody: synthetic peptide derected towards the N terminal of human KL

General description

The gene KL (klotho) encodes a protein that has homology to β-glucosidase enzymes. The gene is mapped to human chromosome 13q12. The gene transcript spans a length of 5.2kb. Alternative splicing leads to the generation of two forms, a transmembrane and a secreted form. The transmembrane protein contains 1014 amino acids.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Biochem/physiol Actions

The KL (klotho) gene is also referred to as an anti-aging gene as it encodes a senescence-related molecule. It regulates fibroblast growth factor (FGF) 23 signaling by functioning as a cofactor or coreceptor. It is involved in the activation of TRPV5 (transient receptor potential cation channel subfamily V member 5), an ion channel, by functioning as a glucuronidase. Klotho affects several intracellular signaling pathways, such as p53/p21, cAMP, protein kinase C (PKC) and Wnt signaling pathways. Mutations in this gene have been associated with premature aging-like phenotypes and shortened life span. Single nucleotide polymorphisms in this gene have been associated with priapism in sickle cell anaemia.

Sequence

Synthetic peptide located within the following region: FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLP

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?