• USA Home
  • SAB2105035 - Anti-GEM, (N-terminal) antibody produced in rabbit

EMAIL THIS PAGE TO A FRIEND
SAB2105035 Sigma

Anti-GEM, (N-terminal) antibody produced in rabbit

affinity isolated antibody

Synonym: Anti-KIR, Anti-MGC26294

Purchase

Properties

Related Categories Alphabetical Index, Antibodies, GD-GL, Primary Antibodies
species reactivity   guinea pig, horse, rabbit, human, mouse
application(s)   western blot: suitable
clone   polyclonal
concentration   0.5 mg - 1 mg/mL
antibody form   affinity isolated antibody
form   buffered aqueous solution
mol wt   mol wt 34 kDa
shipped in   wet ice
storage temp.   −20°C
Gene Information   human ... GEM(2669)
biological source   rabbit
conjugate   unconjugated
NCBI accession no.   NM_005261

Description

Immunogen

The immunogen for anti-GEM antibody: synthetic peptide derected towards the N terminal of human GEM

General description

The gene GEM (GTP binding protein overexpressed in skeletal muscle) is mapped to human chromosome 8q22-24. It belongs to the Ras superfamily and RGK (for Rad and Kir/Gem) family. The encoded protein has Ras-like core and extended N and C termini.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Biochem/physiol Actions

GEM (GTP binding protein overexpressed in skeletal muscle) is a guanosine triphosphate (GTP)-binding protein. It controls voltage gated Ca2+ channels and cytoskeleton dynamics. Overexpression of GEM causes disruption of stress fiber, changes in cell shape and neurite elongation in interphase cells. In addition, it is also involved in actin remodelling during mitosis. In Timothy syndrome, overexpression of GEM leads to inactivation of RhoA, thereby preventing dendritic retraction. GEM might also be associated with cell invasiveness. In HTLV-1 retrovirus (human T-cell leukemia virus type 1) infection, GEM is involved in cell-to-cell viral transmission.

Sequence

Synthetic peptide located within the following region: KEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQ

Price and Availability


Antibody Explorer

Explore with Confidence
Safety & Documentation

Safety Information

RIDADR  NONH for all modes of transport
WGK Germany  3
Protocols & Articles

Related Content

Antibody Explorer | Buy Primary & Secondary Antibodies

Monoclonal and polyclonal primary antibodies are focused on cell biology, neurobiology and molecular biology. Secondary antibodies targeting multiple host’s IgG are conjugated to alkaline phosphatase...
Keywords: Amplification, Buffers, Cell biology, Enzyme-linked immunosorbent assay, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Molecular biology, Phosphorylations, Purification, Western blot

Peer-Reviewed Papers
15

References

Related Products

Technical Service:

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Bulk Ordering & Pricing:

Need larger quantities for your development, manufacturing or research applications?